238 Free Photos of Make A Photo

historyhistoricalnational child labor committee collectioncheckflickrstarlibrarydigitalarchivepingnewsmake historyblack and white
Hands Making a Heart Shape 2020
peopleheart
Jorj Barbershop In Iran
peopleartist
Jorj Barbershop In Iran
peopleartist
Salmon gather at the bottom of a waterfall to make their way to spawning grounds in the Katmai Preserve NPS Photo/Russ Taylor
landscapewater
Banksy - Great Art Is All In The Composition
photographypicture
His Holiness Dilgo Khyentse Rinpoche - making the perfection mudra and gaze like Padmasambhava, Seattle Sakya Lhakang 1976, Washington State, USA, photo by Chris Wilkinson
lightusa
Gentaltaret av Jan van Eyck - Hallwylska museet - 104478
historicalhistory
8 mai 2010, making of, photo by lilicomanche, process by …
peoplecity
A Chance Vought F4U Corsair makes a jet assisted take-off.…
historyww2
The United Consolidated School near Charleston, W. Va. Also note photo of The Tate School, one of the two schools that were abandoned to make this. LOC nclc.04369
historicalhistory
385219 Making Gloves, Meadow Cr, Columbia NF, WA 1
historyforest
Umpqua NF - Trail Making
nationalforest
Released to Public: Replica of Godspeed Passes Statue of Liberty by NASA photographer (NASA)
vehiclewater
Percolator
coffee percolatorphotography
20190611 Mt Ellinor with snow. Stay on durable surfaces and make sure to pack out all food scraps to keep wildlife wild! Photo by Joel Nowack
landscaperock
Smoking Woman Making a Phone Call
streetspeople
Invading American Coast Guardsmen and soldiers make friend…
historicalhistory
SC 270865 - Members of the 126th Mt. Engrs., 10th Mt. Div., and a TD of the 701st TD await their chance to make the 300 yards into Tole.
army medical departmentitaly
Watch Co., (6 boys of questionable age, but could not get photo of them.) These machines automatically make the tiny screws used in watches- One man tends to 14 machines. A lesson for glass LOC cph.3b15914
historicalhistory
Brush-making late at night. Photo taken at 9-00 P.M., and they work later. Girls are 12 and 14 years old and go to school working in the morning before school and at night after studying is LOC nclc.04152
historicalhistory
Photo taken after 9 P.M. Mrs. Barattini, Janitress at 212 Sullivan St., N.Y., and son Louis, 14 years old, and daughter who works in a flower factory all day and helps her mother make these LOC nclc.04140
historicalhistory
5 P.M. Making dolls legs for Campbell Kids. Cattena family, 71 Sullivan St., 5(th) floor front. As soon as the photo was taken, Rose carried the box full of finished legs to the Aetna Doll LOC nclc.04143
historicalhistory
No Known Restrictions: Woman and Child from Matson Collection, ca. 1898-1946? (LOC)
childrenmedicine
Mrs. Larocca, 233 E. 107th St., N.Y., making willow plumes in an unlicensed tenement. Photo taken Feb. 29, 1912. License was revoked Dec. 19, 1911.Applied for again Feb 7, 1912, inspected LOC nclc.04203
historicalhistory
340293 CCC Camp Tumwater, Making Pipeline, Wenatchee NF, WA
historyforest
520868 B-17 Air Tanker Makes Drop, Wenatchee NF, WA 1970
vehicleforest
Eleven year old newsie who has been selling for three years. He gets up at 2-30 A.M. Sundays, and at 5-00 A.M. school days. Makes about $1.25 a day. Norval Sharp. Photo taken early Sunday LOC nclc.03883
historicalhistory
Yetta Leider, making hair-goods for Mowshowitz (of 178 E. 2nd St., N.Y., see photo 2878) 2nd floor front in dirty and ill-kept bed-room at 81 Ridge St., N.Y. Dark kitchen and inner bed-room LOC nclc.04201
historicalhistory
Flower making. A night scene (Photo at 10-30 P.M. and not finished, Jan 29, 1912). Carrie Brindisi,12 years old, 134 1-2 Thompson Street, 2(nd) fl(oor) front. Carries (sic) goes to school. LOC nclc.04139
historicalhistory
A Night Scene (Photo by 9-00 P.M.) Flower making. Family of Mary Bezzola, 212 Sullivan St., N.Y. George (10 years old) and Levia (9 years old) work until 9-00 P.M. when work is rushing. LOC nclc.04141
historicalhistory
No Known Restrictions: Harlem Newsboy by Gordon Parks, 1943 (LOC)
new yorkhistory
Gerlache Strait on the Antarctic Peninsula by David Mobley (NOAA)
landscapehistory
No Known Restrictions: "Cairo: Citadel and tombs" by Antonio Beato, between 1870-1890 (LOC)
monumenthistory
Public Domain: Marine in Da Nang, Vietnam by Unknown Photographer, August 1965 (NARA)
historygun
No Known Restrictions: Inez Milholland Boissevain for Women's Suffrage, 1913, George Grantham Bain Collection (LOC)
historypeople
World Trade Center Before 9/11 (NOAA/unidentified fotog)
new yorkskyline
Al fresco dining The Little Old Toll House Allington Lock. Maidstone Kent
blue skycafe
MY Dad Says It Makes Me Look Clever -- Does IT?
christmasboys
201 - 238 of 238
/ 3